PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G183500.1.p
Common NamePRUPE_ppa017571mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 361aa    MW: 40488.9 Da    PI: 6.2367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G183500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-131461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg WT+eEd +++    ++G+ +W++ +++ g++R++k+c++rw +yl
  Prupe.5G183500.1.p 14 RGLWTEEEDAKILAHGSKHGNSNWTAFPKKAGLTRCGKSCRLRWTNYL 61
                        788*******************************************97 PP

2Myb_DNA-binding42.51.5e-1369110346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++T+ E+el+v++++  G++ W  Ia+ ++ gRt+k++k++w++
  Prupe.5G183500.1.p  69 SFTPHEEELIVRLHATIGSR-WPIIAQQLP-GRTDKDVKNYWNT 110
                         79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-21664IPR009057Homeodomain-like
PROSITE profilePS5129413.653961IPR017930Myb domain
SuperFamilySSF466898.44E-2612108IPR009057Homeodomain-like
SMARTSM007171.6E-91363IPR001005SANT/Myb domain
PfamPF002491.8E-121461IPR001005SANT/Myb domain
CDDcd001672.06E-81761No hitNo description
PROSITE profilePS5129420.95862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2365116IPR009057Homeodomain-like
SMARTSM007178.9E-1366114IPR001005SANT/Myb domain
PfamPF002499.9E-1269110IPR001005SANT/Myb domain
CDDcd001671.75E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MVRPACCEKL HLKRGLWTEE EDAKILAHGS KHGNSNWTAF PKKAGLTRCG KSCRLRWTNY  60
LRPNLKHESF TPHEEELIVR LHATIGSRWP IIAQQLPGRT DKDVKNYWNT KLKKKLSEMG  120
IDHVTHKPFS QILADYGNIG GLPKAGMRMA IGSLNKDLKN AILMKPELPY SLSTQGFSNI  180
NSHLMPMTMI PIKMEPIQDS FLSNAQSSNQ PFDLLTQLQA IRLVTEASNS TNLESSPPNL  240
YIHEGTLSSS PSSSTCSSAA QEQATLQAFS WSDFLLEDAF FPTSDAQEHE DKAEHSSMDM  300
LNQSKAAIPQ SQIEDQAGMQ KYNEVEATSP CDSSFVEAMV ARENEMFLEF PQLMEEPFYY  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211249.10.0hypothetical protein PRUPE_ppa017571mg
TrEMBLM5WT280.0M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-69MYB family protein